Manual
Input – Peptide Sequences
Input a set of peptide sequences in FASTA format. Each sequence should start with a header line beginning with ">" followed by a sequence identifier, and the amino acid sequence in the subsequent line(s).
>Peptide1
AAKIILNPKFR
>Peptide2
KWKLFKKIEKVGQNIRDGIIKAGSAVAVVGQAATIYK
You can either type sequences directly in the text area or upload a FASTA file.
Input – Prediction Parameters
Select prediction models for hemolytic activity:
BERT-HemoPep60- This model predicts quantitative hemolytic activity indicators (HC5, HC10, HC50)
HC indicators:
- HC5 - Concentration (μM) required to cause 5% hemolysis
- HC10 - Concentration (μM) required to cause 10% hemolysis
- HC50 - Concentration (μM) required to cause 50% hemolysis
Note: Lower HC values indicate stronger hemolytic activity (higher toxicity).
Input – Job Description (Optional)
A short description can be supplied together with a job submission. The description will be displayed in your job list.
Input – Email (Required)
If you provide an email to your submitted job, you can easily retrieve all your past job results by giving your email. Note that we will not send you any emails about your job run.
Input – Submit
Click the submit button when ready. A job ID will be given to your submitted job; a status page will be displayed with automatically refreshing function to check for the running status of your job. As soon as the run is finished, the result will be displayed in the same window. Please bookmark the status page before leaving the window, so that you can check back the result later. Or if you have provided an email during job submission, you can enter your email at the Input page to login and retrieve all your past job results.
Result Interpretation
The prediction results include three hemolytic activity indicators:
- HC5: Concentration (μM) required to cause 5% hemolysis
- HC10: Concentration (μM) required to cause 10% hemolysis
- HC50: Concentration (μM) required to cause 50% hemolysis
Important: Lower values indicate stronger hemolytic activity (higher toxicity), while higher values indicate weaker hemolytic activity (lower toxicity).
For example, a peptide with HC50 = 10 μM is more hemolytic (more toxic) than a peptide with HC50 = 100 μM.
